PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G026300.2
Common NameB456_008G026300, LOC105762834
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 327aa    MW: 36257 Da    PI: 9.1848
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G026300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1054.4e-33181236156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Gorai.008G026300.2 181 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 236
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-18178239IPR009057Homeodomain-like
PROSITE profilePS5129414.115178238IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-29179239IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-27181236IPR006447Myb domain, plants
PfamPF002494.6E-8183234IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MSRNVEPVLE EFIPLKNKKE NNRSEEDGAL ITNKKEKDSN NNCNNNKDKK NWMSSVQLWN  60
TDDDYSSISH KLDSKRKDGD SSQGCKNRGT ATAFMPFKMN LGFAVRKEEK EEIPVHGLTL  120
LTPGIKNLKE ESCSTGSRTS CSRAVSSSAP NAQSTFRSVP QPLSHHQQQQ QQQQQQQTAR  180
KQRRCWSPEL HRRFVNALQQ LGGSQVATPK QIRELMQVDG LTNDEVKSHL QKYRLHTRRV  240
PASTTSPANQ SVVVLGSGLW MSQDQYGESS KGSSSQSGSP QGPLQLATNT GGTSNPGGDS  300
MEDDEDAKSE SYSWKSHIHK PGKDDV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436209.10.0PREDICTED: uncharacterized protein LOC105762834
TrEMBLA0A0D2STM10.0A0A0D2STM1_G
TrEMBLA0A0D2SZ850.0A0A0D2SZ85_G
STRINGVIT_03s0063g01060.t011e-122(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.12e-36G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]